HPA023892

TMEM245 antibody from Sigma-Aldrich
C9orf5, CG-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023892
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023892, RRID:AB_1845828
Product name
Anti-C9orf5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023892
Antibody type
Polyclonal
Antigen
Transmembrane protein C9orf5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AELPGQVISMAASTLANLAISITGYESSSEDQPST
QPAEAVDRGESAPTLSTSPSPSSPSPTSPSPTLGR
RRPEIGTFLRKKK
Storage
-20C
Provider Type Product Number
- No reagents -