Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1108445 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Nuclear Factor I/X (MLZE) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NFIX antibody: synthetic peptide directed towards the middle region of human NFIX
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
YFVHTPESGQSDSSNQQGDADIKPLPNGHLSFQDC
FVTSGVWNVTELVRV- Epitope
- Middle Region
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references RFX1 and NF-1 associate with P sequences of the human growth hormone locus in pituitary chromatin.
Norquay LD, Yang X, Sheppard P, Gregoire S, Dodd JG, Reith W, Cattini PA
Molecular endocrinology (Baltimore, Md.) 2003 Jun;17(6):1027-38
Molecular endocrinology (Baltimore, Md.) 2003 Jun;17(6):1027-38
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Jurkat; WB Suggested Anti-NFIX Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysate; NFIX antibody - middle region (AP42133PU-N) in Human Jurkat cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- mouse hippocampus; DG of Hippocampus. Dilution:. 1:200; NFIX antibody - middle region (AP42133PU-N) in mouse hippocampus cells using Immunohistochemistry
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Prostate; Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0ug/ml using anti-NFIX antibody (AP42133PU-N); NFIX antibody - middle region (AP42133PU-N) in Human Prostate cells using Immunohistochemistry