HPA005157

TYK2 antibody from Sigma-Aldrich
JTK1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005157
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005157, RRID:AB_1858480
Product name
Anti-TYK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005157
Antibody type
Polyclonal
Antigen
Non-receptor tyrosine-protein kinase TYK2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RFLRDFQPGRLSQQMVMVKYLATLERLAPRFGTER
VPVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAA
GPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSG
RNPQASLFGKKAKAHKAFGQPADRPREPLWAYFCD
FRDITHVV
Storage
-20C
Provider Type Product Number
- No reagents -