HPA018312

HCFC1 antibody from Sigma-Aldrich
CFF, HCF-1, HCF1, HFC1, MGC70925, MRX3, PPP1R89, VCAF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018312
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018312, RRID:AB_1850522
Product name
Anti-HCFC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018312
Antibody type
Polyclonal
Antigen
Host cell factor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSPAFVQLAPLSSKVRLSSPSIKDLPAGRHSHAVS
TAAMTRSSVGAGEPRMAPVCESLQGGSPSTTVTVT
ALEALLCPSATVTQVCSNPPCETHETGTTN
Storage
-20C
Provider Type Product Number
- No reagents -