Antibody data

Product number
ABIN501365
Provider
antibodies-online
Product name
anti-Glutamate Receptor, Ionotropic, N-Methyl D-Aspartate 2B (GRIN2B) antibody
Provider product page
antibodies-online - ABIN501365
Antibody type
Polyclonal
Antigen
The immunogen for anti-GRIN2B antibody: synthetic peptide directed towards the middle region of human GRIN2B
Reactivity
Human, Mouse, Rat, Canine, Xenopus
Host
Rabbit
Antigen sequence
RSPDHKRYFRDKEGLRDFYLDQFRTKENSPHWEHV
DLTDI YKERSDDFKR
Vial size
50 µg
Provider Type Product Number
- No reagents -