HPA027818

ZBTB8B antibody from Sigma-Aldrich
DKFZp547H154, RP1-27O5.1, ZNF916B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027818
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027818, RRID:AB_10599417
Product name
Anti-ZBTB8B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027818
Antibody type
Polyclonal
Antigen
zinc finger and BTB domain containing 8B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVECLRESPCGDCGDCHPLELVVRDSLGGGSADSN
LSTPPKRIEPKVEFDADEVEVDVGEQLQQYAAPLN
Storage
-20C
Provider Type Product Number
- No reagents -