HPA028690

ZBTB8B antibody from MilliporeSigma / Merck KGaA
DKFZp547H154, RP1-27O5.1, ZNF916B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028690
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028690, RRID:AB_10600897
Product name
Anti-ZBTB8B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028690
Antibody type
Polyclonal
Antigen
zinc finger and BTB domain containing 8B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGKLDLCGENVIEVMSAASYLQMNDVVNFCKTYIR
SSLDICRKMEKEAAVAAAVAAAAAAAAAAAAAAAH
QVDSESPSSGREGTSCGTKSLVSSPA
Storage
-20C
Provider Type Product Number
- No reagents -