HPA018530

EGFR antibody from Atlas Antibodies
ERBB, ERBB1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018530
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018530, RRID:AB_1848044
Product name
Anti-EGFR
Provider product page
Atlas Antibodies - HPA018530
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNG
LQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPV
PEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPH
YQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQ
KGSHQISLD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -