HPA019646

MYO18A antibody from Sigma-Aldrich
KIAA0216, MysPDZ
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019646
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019646, RRID:AB_1854249
Product name
Anti-MYO18A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019646
Antibody type
Polyclonal
Antigen
Myosin-XVIIIa recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEVMEMEVMEARLIRAAEINGEVDDDDAGGEWRLK
YERAVREVDFTKKRLQQEFEDKLEVEQQNKRQLER
RLGDLQADSEESQRALQQLKKKCQRLT
Storage
-20C
Provider Type Product Number
- No reagents -