Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406694 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ER Lipid Raft Associated 2 (ERLIN2) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ERLIN2 antibody: synthetic peptide directed towards the middle region of human ERLIN2
- Reactivity
- Human, Mouse, Rat, Porcine
- Host
- Rabbit
- Antigen sequence
ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLS
FGLED EPLETATKEN- Vial size
- 50 µg
Submitted references Effects of 1.8 GHz radiofrequency radiation on protein expression in human lens epithelial cells.
SPFH2 mediates the endoplasmic reticulum-associated degradation of inositol 1,4,5-trisphosphate receptors and other substrates in mammalian cells.
Zhang Y, Yao K, Yu Y, Ni S, Zhang L, Wang W, Lai K
Human & experimental toxicology 2013 Aug;32(8):797-806
Human & experimental toxicology 2013 Aug;32(8):797-806
SPFH2 mediates the endoplasmic reticulum-associated degradation of inositol 1,4,5-trisphosphate receptors and other substrates in mammalian cells.
Pearce MM, Wang Y, Kelley GG, Wojcikiewicz RJ
The Journal of biological chemistry 2007 Jul 13;282(28):20104-15
The Journal of biological chemistry 2007 Jul 13;282(28):20104-15
No comments: Submit comment
No validations: Submit validation data