HPA002025

ERLIN2 antibody from Sigma-Aldrich
C8orf2, Erlin-2, NET32, SPFH2, SPG18
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002025
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002025, RRID:AB_1080077
Product name
Anti-ERLIN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002025
Antibody type
Polyclonal
Antigen
SPFH domain-containing protein 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQV
AEITYGQKVMEKETEKKISEIEDAAFLAREKAKAD
AECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSK
IYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLED
EPLETATK
Storage
-20C
Provider Type Product Number
- No reagents -