H00283933-B01P

ZNF843 antibody from Abnova Corporation
MGC46336
No application information provided.

Antibody data

Product number
H00283933-B01P
Provider
Abnova Corporation
Product name
ZNF843 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00283933-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ZNF843 protein.
Antigen sequence
MRSLPFALTVESVSARAPTCCSTGRFTQGRQPCKC
KACGRGFTQSASLLQHWRVHSDWRETLSLSPVRQD
LLWPLQPHQAPASPLGRSHSSAGVRQGFSGQLCCW
LTKEHTLAEALRLSPVPAGFWGPVEADRPPANSHR
RVCPFCCCSCGDSVNEKTSLSQRVLPHPGEKTCRG
GSVESVSLAPSSVAPDSTSGLRPCGSPGSFLQHLP
PSTLLPRPPFLYPGPPLSLQPLVPSGLPAVPAVPL
GGLEVAQVPPATQPAAQQEGAMGPRSCASAGRDSR
EAVQAPGYPEPARKASQHRAAGPLGEARARLQRQC
RAPPPPSNPHWRGALPVFPVWKASSRRSNLARH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -