AV40116

ZNF843 antibody from Sigma-Aldrich
MGC46336
No application information provided.

Antibody data

Product number
AV40116
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV40116, RRID:AB_1853904
Product name
Anti-MGC46336 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV40116
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human MGC46336 with an internal ID of P22011
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GFTQSASLLQHWRVHSDWRETLSLSPVRQDLLWPL
QPHQAPASPLGRSHS
Storage
-20C
Provider Type Product Number
- No reagents -