HPA023481

FRRS1L antibody from Sigma-Aldrich
C9orf4, CG-6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023481
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023481, RRID:AB_1845823
Product name
Anti-C9orf4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023481
Antibody type
Polyclonal
Antigen
Uncharacterized protein C9orf4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CDYFLSYRMIGADVEFELSADTDGWVAVGFSSDKK
MGGDDVMACVHDDNGRVRIQHFYNVGQWAKEIQRN
PARDEEGVFENNRVTCRFKRPVNVPRDETIVDLHL
SWYYLFAWGPAIQGSITRHDIDSPPASERVVSIYK
YED
Storage
-20C
Provider Type Product Number
- No reagents -