HPA000868

FBLN5 antibody from Atlas Antibodies
ARMD3, DANCE, EVEC, UP50

Antibody data

Product number
HPA000868
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000868, RRID:AB_1078619
Product name
Anti-FBLN5
Provider product page
Atlas Antibodies - HPA000868
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMM
CVNQNGGYLCIPRTNPVYRGPYSNPYSTPYSGPYP
AAAPPLSAPNYPTISRPLICRFGYQMDESNQCVDV
DECATDSHQCNPTQICINTEGGYTCSCTDGYWLLE
GQCLDIDEC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.