HPA000848

FBLN5 antibody from Sigma-Aldrich
ARMD3, DANCE, EVEC, UP50
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000848
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000848, RRID:AB_1078620
Product name
Anti-FBLN5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000848
Antibody type
Polyclonal
Antigen
Fibulin-5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TYFCSCPPGYILLDDNRSCQDINECEHRNHTCNLQ
QTCYNLQGGFKCIDPIRCEEPYLRISDNRCMCPAE
NPGCRDQPFTILYRDMDVVSGRSVPADIFQMQATT
RYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMT
RPIKGPR
Storage
-20C
Provider Type Product Number
- No reagents -