HPA049516

OR4C5 antibody from Atlas Antibodies
OR4C5P, OR4C5Q

Antibody data

Product number
HPA049516
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA049516, RRID:AB_2680800
Product name
Anti-OR4C5
Provider product page
Atlas Antibodies - HPA049516
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MYVSNCNPCAIHRKINYPNTKLDFEQVNNITEFIL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.