Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501299 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ERGIC and Golgi 2 (ERGIC2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ERGIC2 antibody: synthetic peptide directed towards the middle region of human ERGIC2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
TVVPTKLHTYKISADTHQFSVTERERIINHAAGSH
GVSGI FMKYDLSSLM- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The possible interaction of CDA14 and protein elongation factor 1alpha.
Protection against beta-amyloid-induced apoptosis by peptides interacting with beta-amyloid.
Yang YF, Chou MY, Fan CY, Chen SF, Lyu PC, Liu CC, Tseng TL
Biochimica et biophysica acta 2008 Feb;1784(2):312-8
Biochimica et biophysica acta 2008 Feb;1784(2):312-8
Protection against beta-amyloid-induced apoptosis by peptides interacting with beta-amyloid.
Nelson TJ, Alkon DL
The Journal of biological chemistry 2007 Oct 26;282(43):31238-49
The Journal of biological chemistry 2007 Oct 26;282(43):31238-49
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting