Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183775 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ERGIC and Golgi 2 (ERGIC2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ERGIC2 antibody: synthetic peptide directed towards the N terminal of human ERGIC2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MRRLNRKKTLSLVKELDAFPKVPESYVETSASGGT
VSLIA FTTMALLTIM- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Proteomics of endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membranes from brefeldin A-treated HepG2 cells identifies ERGIC-32, a new cycling protein that interacts with human Erv46.
Breuza L, Halbeisen R, Jenö P, Otte S, Barlowe C, Hong W, Hauri HP
The Journal of biological chemistry 2004 Nov 5;279(45):47242-53
The Journal of biological chemistry 2004 Nov 5;279(45):47242-53
No comments: Submit comment
No validations: Submit validation data