H00055004-B01P

LAMTOR1 antibody from Abnova Corporation
C11orf59, FLJ20625, p18, p27RF-Rho, Pdro, Ragulator1
No application information provided.

Antibody data

Product number
H00055004-B01P
Provider
Abnova Corporation
Product name
C11orf59 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00055004-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C11orf59 protein.
Antigen sequence
MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNG
AEPNYHSLPSARTDEQALLSSILAKTASNIIDVSA
ADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKL
PPLPSLTSQPHQVLASEPIPFSDLQQVSRIAAYAY
SALSQIRVDAKEELVVQFGIP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -