HPA002997

LAMTOR1 antibody from Atlas Antibodies
C11orf59, FLJ20625, p18, p27RF-Rho, Pdro, Ragulator1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002997
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002997, RRID:AB_1845531
Product name
Anti-LAMTOR1
Provider product page
Atlas Antibodies - HPA002997
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSL
PSARTDEQALLSSILAKTASNIIDVSAADSQGMEQ
HEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTS
QPHQVLASEPIPFSDLQQVSRIAAYAYSALSQIRV
DAKEELVV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -