HPA002997

LAMTOR1 antibody from Sigma-Aldrich
C11orf59, FLJ20625, p18, p27RF-Rho, Pdro, Ragulator1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002997
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002997, RRID:AB_1845531
Product name
Anti-C11orf59 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002997
Antibody type
Polyclonal
Antigen
UPF0404 protein C11orf59 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSL
PSARTDEQALLSSILAKTASNIIDVSAADSQGMEQ
HEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTS
QPHQVLASEPIPFSDLQQVSRIAAYAYSALSQIRV
DAKEELVV
Storage
-20C
Provider Type Product Number
- No reagents -