Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB20051 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB20051, RRID:AB_10961820
- Product name
- CCDC50 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant CCDC50.
- Antigen sequence
QEKKDEDIARLLQEKELQEEKKRKKHFPEFPATRA
YADSYYYEDGGMKPRVMKEAVSTPSRMAHRDQEWY
DAEIARKLQEEELLATQVDMRAAQVAQDEEIARLL
MAEEKKAYKKAKEREKSSLDKRKQDPEWKPKTAKA
ANSKSKESDE- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with CCDC50 polyclonal antibody (Cat # PAB20051) at 1:250-1:500 dilution.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of cell lysates with CCDC50 polyclonal antibody (Cat # PAB20051) at 1:250-1:500 dilution.Lane 1 : NIH/3T3Lane 2 : NBT-II
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-251 MG with CCDC50 polyclonal antibody (Cat # PAB20051) at 1-4 ug/mL dilution shows positivity in cytoplasm.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human lymph node with CCDC50 polyclonal antibody (Cat # PAB20051) shows strong cytoplasmic positivity in a subset of lymphoid cells outside reaction center at 1:1000-1:2500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)