HPA001336

CCDC50 antibody from Atlas Antibodies
C3orf6, DFNA44, Ymer
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001336
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001336, RRID:AB_1078421
Product name
Anti-CCDC50
Provider product page
Atlas Antibodies - HPA001336
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QEKKDEDIARLLQEKELQEEKKRKKHFPEFPATRA
YADSYYYEDGGMKPRVMKEAVSTPSRMAHRDQEWY
DAEIARKLQEEELLATQVDMRAAQVAQDEEIARLL
MAEEKKAYKKAKEREKSSLDKRKQDPEWKPKTAKA
ANSKSKESDE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -