HPA001336

CCDC50 antibody from Sigma-Aldrich
C3orf6, DFNA44, Ymer
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001336
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001336, RRID:AB_1078421
Product name
Anti-CCDC50 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001336
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 50 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEKKDEDIARLLQEKELQEEKKRKKHFPEFPATRA
YADSYYYEDGGMKPRVMKEAVSTPSRMAHRDQEWY
DAEIARKLQEEELLATQVDMRAAQVAQDEEIARLL
MAEEKKAYKKAKEREKSSLDKRKQDPEWKPKTAKA
ANSKSKESDE
Storage
-20C
Provider Type Product Number
- No reagents -