HPA021520

SVEP1 antibody from Sigma-Aldrich
bA427L11.3, C9orf13, FLJ13529, POLYDOM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021520
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021520, RRID:AB_1855533
Product name
Anti-SVEP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021520
Antibody type
Polyclonal
Antigen
Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCA
YEDGVWKPTYTTEWPDCAKKRFANHGFKSFEMFYK
AARCDDTDLMKKFSEAFETTLG
Storage
-20C
Provider Type Product Number
- No reagents -