Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009554-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009554-M01, RRID:AB_530195
- Product name
- SEC22L1 monoclonal antibody (M01), clone 1E1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SEC22L1.
- Antigen sequence
MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQS
QAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVC
YLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPT
VSRPY- Isotype
- IgG
- Antibody clone number
- 1E1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A VAMP7/Vti1a SNARE complex distinguishes a non-conventional traffic route to the cell surface used by KChIP1 and Kv4 potassium channels.
Quantitative and temporal proteome analysis of butyrate-treated colorectal cancer cells.
Flowerdew SE, Burgoyne RD
The Biochemical journal 2009 Mar 15;418(3):529-40
The Biochemical journal 2009 Mar 15;418(3):529-40
Quantitative and temporal proteome analysis of butyrate-treated colorectal cancer cells.
Tan HT, Tan S, Lin Q, Lim TK, Hew CL, Chung MC
Molecular & cellular proteomics : MCP 2008 Jun;7(6):1174-85
Molecular & cellular proteomics : MCP 2008 Jun;7(6):1174-85
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SEC22L1 monoclonal antibody (M01), clone 1E1 Western Blot analysis of SEC22L1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SEC22L1 monoclonal antibody (M01), clone 1E1. Western Blot analysis of SEC22L1 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SEC22L1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SEC22L1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol