HPA002191

STX3 antibody from Sigma-Aldrich
STX3A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002191
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002191, RRID:AB_1080165
Product name
Anti-STX3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002191
Antibody type
Polyclonal
Antigen
Syntaxin-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KQLTQDDDTDAVEIAIDNTAFMDEFFSEIEETRLN
IDKISEHVEEAKKLYSIILSAPIPEPKTKDDLEQL
TTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRI
RKSQHSVLSRKFVEVMTKYNEAQVDFRERSKGRIQ
RQLEITGK
Storage
-20C
Provider Type Product Number
- No reagents -