HPA027045

OTUD7B antibody from MilliporeSigma / Merck KGaA
CEZANNE, ZA20D1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027045
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027045, RRID:AB_1854847
Product name
Anti-OTUD7B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027045
Antibody type
Polyclonal
Antigen
OTU domain-containing protein 7B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PHQDSIPSLEPGSHSKDGLHRGALLPPPYRVADSY
SNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFY
G
Storage
-20C
Provider Type Product Number
- No reagents -