HPA028179

ACBD6 antibody from Sigma-Aldrich
MGC2404
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028179
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028179, RRID:AB_10601788
Product name
Anti-ACBD6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028179
Antibody type
Polyclonal
Antigen
acyl-Coenzyme A binding domain containing 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGRALLHWACDRGHKELVTVLLQHRADINCQDNEG
QTALHYASACEFLDIVELLLQSGADPTLRDQDGCL
PEEVTGCKTVSLVLQRHTTGKA
Storage
-20C
Provider Type Product Number
- No reagents -