H00029128-M01
antibody from Abnova Corporation
Targeting: UHRF1
FLJ21925, ICBP90, Np95, RNF106, TDRD22
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00029128-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00029128-M01, RRID:AB_463984
- Product name
- UHRF1 monoclonal antibody (M01), clone 3A11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant UHRF1.
- Antigen sequence
WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQ
ELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACR
YDLGRSYAMQVNQPLQTVLNQLFPGYGNGR- Isotype
- IgG
- Antibody clone number
- 3A11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references DNMT1 stability is regulated by proteins coordinating deubiquitination and acetylation-driven ubiquitination.
Interplay between Np95 and Eme1 in the DNA damage response.
Du Z, Song J, Wang Y, Zhao Y, Guda K, Yang S, Kao HY, Xu Y, Willis J, Markowitz SD, Sedwick D, Ewing RM, Wang Z
Science signaling 2010 Nov 2;3(146):ra80
Science signaling 2010 Nov 2;3(146):ra80
Interplay between Np95 and Eme1 in the DNA damage response.
Mistry H, Gibson L, Yun JW, Sarras H, Tamblyn L, McPherson JP
Biochemical and biophysical research communications 2008 Oct 24;375(3):321-5
Biochemical and biophysical research communications 2008 Oct 24;375(3):321-5
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- UHRF1 monoclonal antibody (M01), clone 3A11 Western Blot analysis of UHRF1 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to UHRF1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to UHRF1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol