H00029128-M02
antibody from Abnova Corporation
		Targeting: UHRF1
		
		FLJ21925, ICBP90, Np95, RNF106, TDRD22	
	
	
	
	
Antibody data
- Antibody Data
 - Antigen structure
 - References [0]
 - Comments [0]
 - Validations
 - Western blot [1]
 - ELISA [1]
 - Immunocytochemistry [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00029128-M02 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00029128-M02, RRID:AB_914022
 - Product name
 - UHRF1 monoclonal antibody (M02), clone 3B12
 - Antibody type
 - Monoclonal
 - Description
 - Mouse monoclonal antibody raised against a partial recombinant UHRF1.
 - Antigen sequence
 WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQ
ELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACR
YDLGRSYAMQVNQPLQTVLNQLFPGYGNGR- Isotype
 - IgG
 - Antibody clone number
 - 3B12
 - Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - UHRF1 monoclonal antibody (M02), clone 3B12 Western Blot analysis of UHRF1 expression in MCF-7 ( Cat # L046V1 ).
 
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Detection limit for recombinant GST tagged UHRF1 is approximately 1ng/ml as a capture antibody.
 - Validation comment
 - Sandwich ELISA (Recombinant protein)
 - Protocol
 - Protocol
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunofluorescence of monoclonal antibody to UHRF1 on MCF-7 cell . [antibody concentration 10 ug/ml]
 - Validation comment
 - Immunofluorescence
 - Protocol
 - Protocol