H00029128-M02
antibody from Abnova Corporation
Targeting: UHRF1
FLJ21925, ICBP90, Np95, RNF106, TDRD22
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00029128-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00029128-M02, RRID:AB_914022
- Product name
- UHRF1 monoclonal antibody (M02), clone 3B12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant UHRF1.
- Antigen sequence
WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQ
ELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACR
YDLGRSYAMQVNQPLQTVLNQLFPGYGNGR- Isotype
- IgG
- Antibody clone number
- 3B12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- UHRF1 monoclonal antibody (M02), clone 3B12 Western Blot analysis of UHRF1 expression in MCF-7 ( Cat # L046V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged UHRF1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to UHRF1 on MCF-7 cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol