HPA001540

STX8 antibody from Sigma-Aldrich
CARB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001540
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001540, RRID:AB_1080168
Product name
Anti-STX8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001540
Antibody type
Polyclonal
Antigen
Syntaxin-8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTI
RALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRR
QNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSE
EAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQ
EQDAGLD
Storage
-20C
Provider Type Product Number
- No reagents -