HPA025734

LYZL6 antibody from Atlas Antibodies
LYC1, PRO1485, TKAL754
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA025734
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025734, RRID:AB_1853444
Product name
Anti-LYZL6
Provider product page
Atlas Antibodies - HPA025734
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIV
SGARGMNNWVEWRLHCSGRP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -