HPA019100

MIB1 antibody from Sigma-Aldrich
DIP-1, KIAA1323, MIB, ZZANK2, ZZZ6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019100
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019100, RRID:AB_1853934
Product name
Anti-MIB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019100
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase MIB1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDE
DHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQG
AEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAE
AM
Storage
-20C
Provider Type Product Number
- No reagents -