HPA019100

MIB1 antibody from Atlas Antibodies
DIP-1, KIAA1323, MIB, ZZANK2, ZZZ6
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019100
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019100, RRID:AB_1853934
Product name
Anti-MIB1
Provider product page
Atlas Antibodies - HPA019100
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDE
DHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQG
AEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAE
AM
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -