HPA001183

RIMBP3 antibody from Sigma-Aldrich
KIAA1666, RIMBP3.1, RIMBP3A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001183
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001183, RRID:AB_1079205
Product name
Anti-RIMBP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001183
Antibody type
Polyclonal
Antigen
RIMS-binding protein 3A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RDTASEVDDLEPDSVSLALEMGGSAAPAAPKLKIF
MAQYNYNPFEGPNDHPEGELPLTAGDYIYIFGDMD
EDGFYEGELEDGRRGLVPSNFVEQIPDSYIPGCLP
AKSPDLGPSQLPAGQDEALEE
Storage
-20C
Provider Type Product Number
- No reagents -