HPA003019

STX18 antibody from Atlas Antibodies
Ufe1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003019
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003019, RRID:AB_1235770
Product name
Anti-STX18
Provider product page
Atlas Antibodies - HPA003019
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VKRVVDKKRLSKLEPEPNTKTRESTSSEKVSQSPS
KDSEENPATEERPEKILAETQPELGTWGDGKGEDE
LSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGRVV
EISRLQEIFTEKVLQQEAEIDSIHQLVVGATENIK
EGNEDIREAI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -