HPA003019

STX18 antibody from Sigma-Aldrich
Ufe1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003019
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003019, RRID:AB_1857622
Product name
Anti-STX18 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003019
Antibody type
Polyclonal
Antigen
Syntaxin-18 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VKRVVDKKRLSKLEPEPNTKTRESTSSEKVSQSPS
KDSEENPATEERPEKILAETQPELGTWGDGKGEDE
LSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGRVV
EISRLQEIFTEKVLQQEAEIDSIHQLVVGATENIK
EGNEDIREAI
Storage
-20C
Provider Type Product Number
- No reagents -