H00008031-M04
antibody from Abnova Corporation
Targeting: NCOA4
ARA70, DKFZp762E1112, ELE1, PTC3, RFG
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008031-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008031-M04, RRID:AB_875726
- Product name
- NCOA4 monoclonal antibody (M04), clone 1B7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NCOA4.
- Antigen sequence
EGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADW
VLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPL
QEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYR
TPLQM- Isotype
- IgG
- Antibody clone number
- 1B7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Molecular constitution of breast but not other reproductive tissues is rich in growth promoting molecules: a possible link to highest incidence of tumor growths.
Poola I, Abraham J, Marshalleck JJ, Yue Q, Fu SW, Viswanath L, Sharma N, Hill R, Dewitty RL, Bonney G
FEBS letters 2009 Sep 17;583(18):3069-75
FEBS letters 2009 Sep 17;583(18):3069-75
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NCOA4 monoclonal antibody (M04), clone 1B7 Western Blot analysis of NCOA4 expression in NIH/3T3 ( Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NCOA4 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to NCOA4 on NIH/3T3 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol