Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006716-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006716-M01, RRID:AB_894275
- Product name
- SRD5A2 monoclonal antibody (M01), clone 1F4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SRD5A2.
- Antigen sequence
AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFA
VPA- Isotype
- IgG
- Antibody clone number
- 1F4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Resistance training restores muscle sex steroid hormone steroidogenesis in older men.
Sato K, Iemitsu M, Matsutani K, Kurihara T, Hamaoka T, Fujita S
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Apr;28(4):1891-7
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Apr;28(4):1891-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SRD5A2 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol