HPA021598

MRM1 antibody from Sigma-Aldrich
FLJ22578
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021598
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021598, RRID:AB_1854097
Product name
Anti-MRM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021598
Antibody type
Polyclonal
Antigen
rRNA methyltransferase 1, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SCQLLLTILPRRQLPPGLESLNVSVAAGILLHSIC
SQRKGFPTEGERRQLLQDPQEPSARSEGLSMAQHP
GLSS
Storage
-20C
Provider Type Product Number
- No reagents -