H00056001-M08

NXF2 antibody from Abnova Corporation
CT39, TAPL-2
No application information provided.

Antibody data

Product number
H00056001-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00056001-M08, RRID:AB_1137337
Product name
NXF2 monoclonal antibody (M08), clone 4G1
Provider product page
Abnova Corporation - H00056001-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NXF2.
Antigen sequence
DEIRITTWRNRKPPERKMSQNTQDGYTRNWFKVTI
PYGIKYDKAWLMNSIQSHCSDRFTPVDFHYVRNRA
CFFV
Isotype
IgG
Antibody clone number
4G1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -