HPA002083

HNF1B antibody from Sigma-Aldrich
HNF1beta, LFB3, MODY5, TCF2, VHNF1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002083
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002083, RRID:AB_1080232
Product name
Anti-HNF1B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002083
Antibody type
Polyclonal
Antigen
Hepatocyte nuclear factor 1beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPD
TKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPIL
KELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKG
YMQQH
Storage
-20C
Provider Type Product Number
- No reagents -