Antibody data
- Antibody Data
 - Antigen structure
 - References [0]
 - Comments [0]
 - Validations
 - Immunocytochemistry [1]
 - Immunohistochemistry [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - PAB20612 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#PAB20612, RRID:AB_10966125
 - Product name
 - DACH1 polyclonal antibody
 - Antibody type
 - Polyclonal
 - Description
 - Rabbit polyclonal antibody raised against recombinant DACH1.
 - Antigen sequence
 PKRTQSVTSPENSHIMPHSVPGLMSPGIIPPTGLT
AAAAAAAAATNAAIAEAMKVKKIKLEAMSNYHASN
NQHGADSENGDMNSSVGSSDGSWDKETLPSSPSQG
PQASITHPRMPGARSLPLSHPLNHLQQSHLLPNGL
ELP- Isotype
 - IgG
 - Storage
 - Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
 
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunofluorescent staining of human cell line U-2 OS with DACH1 polyclonal antibody (Cat # PAB20612) at 1-4 ug/mL dilution shows positivity in nucleus, nucleoli.
 - Validation comment
 - Immunofluorescence
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunohistochemical staining of human small intestine with DACH1 polyclonal antibody (Cat # PAB20612) shows strong nuclear positivity in glandular cells at 1:200-1:500 dilution.
 - Validation comment
 - Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)