HPA012672

DACH1 antibody from Sigma-Aldrich
DACH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012672
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012672, RRID:AB_1847466
Product name
Anti-DACH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012672
Antibody type
Polyclonal
Antigen
Dachshund homolog 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKRTQSVTSPENSHIMPHSVPGLMSPGIIPPTGLT
AAAAAAAAATNAAIAEAMKVKKIKLEAMSNYHASN
NQHGADSENGDMNSSVGSSDGSWDKETLPSSPSQG
PQASITHPRMPGARSLPLSHPLNHLQQSHLLPNGL
ELP
Storage
-20C
Provider Type Product Number
- No reagents -