WH0026574M4

AATF antibody from MilliporeSigma / Merck KGaA
BFR2, CHE-1, CHE1, DED
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
WH0026574M4
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0026574M4, RRID:AB_2219893
Product name
Monoclonal Anti-AATF antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0026574M4
Antibody type
Monoclonal
Antigen
AATF (AAH00591, a.a. 151-250) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human, Mouse, Rat
Antigen sequence
VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDD
AEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEE
VEKGRAVKNQIALWDQLLEGRIKLQKALLT (wit
hout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -