HPA004940

AATF antibody from Atlas Antibodies
BFR2, CHE-1, CHE1, DED
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004940
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004940, RRID:AB_1078075
Product name
Anti-AATF
Provider product page
Atlas Antibodies - HPA004940
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGD
DAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSE
EVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQL
PQPDVFPLFKDKGGPEFSSALKNSHKALKALLTSL
VGLQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -