HPA004940

AATF antibody from Sigma-Aldrich
BFR2, CHE-1, CHE1, DED
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004940
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004940, RRID:AB_1078075
Product name
Anti-AATF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004940
Antibody type
Polyclonal
Antigen
Protein AATF recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGD
DAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSE
EVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQL
PQPDVFPLFKDKGGPEFSSALKNSHKALKALLTSL
VGLQ
Storage
-20C
Provider Type Product Number
- No reagents -