Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00338382-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00338382-M01, RRID:AB_535003
- Product name
- RAB7B monoclonal antibody (M01), clone 3B3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RAB7B.
- Antigen sequence
DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVP
QEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLAS
RALSRYQSILENHLTESIKLSPDQSRSRCC- Isotype
- IgG
- Antibody clone number
- 3B3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A novel interaction between Rab7b and actomyosin reveals a dual role in intracellular transport and cell migration.
Clathrin-dependent mechanisms modulate the subcellular distribution of class C Vps/HOPS tether subunits in polarized and nonpolarized cells.
GIGYF2 is present in endosomal compartments in the mammalian brains and enhances IGF-1-induced ERK1/2 activation.
Abnormal localization of leucine-rich repeat kinase 2 to the endosomal-lysosomal compartment in lewy body disease.
SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery.
Borg M, Bakke O, Progida C
Journal of cell science 2014 Nov 15;127(Pt 22):4927-39
Journal of cell science 2014 Nov 15;127(Pt 22):4927-39
Clathrin-dependent mechanisms modulate the subcellular distribution of class C Vps/HOPS tether subunits in polarized and nonpolarized cells.
Zlatic SA, Tornieri K, L'Hernault SW, Faundez V
Molecular biology of the cell 2011 May 15;22(10):1699-715
Molecular biology of the cell 2011 May 15;22(10):1699-715
GIGYF2 is present in endosomal compartments in the mammalian brains and enhances IGF-1-induced ERK1/2 activation.
Higashi S, Iseki E, Minegishi M, Togo T, Kabuta T, Wada K
Journal of neurochemistry 2010 Oct;115(2):423-37
Journal of neurochemistry 2010 Oct;115(2):423-37
Abnormal localization of leucine-rich repeat kinase 2 to the endosomal-lysosomal compartment in lewy body disease.
Higashi S, Moore DJ, Yamamoto R, Minegishi M, Sato K, Togo T, Katsuse O, Uchikado H, Furukawa Y, Hino H, Kosaka K, Emson PC, Wada K, Dawson VL, Dawson TM, Arai H, Iseki E
Journal of neuropathology and experimental neurology 2009 Sep;68(9):994-1005
Journal of neuropathology and experimental neurology 2009 Sep;68(9):994-1005
SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery.
Zhu GD, Salazar G, Zlatic SA, Fiza B, Doucette MM, Heilman CJ, Levey AI, Faundez V, L'hernault SW
Molecular biology of the cell 2009 Feb;20(4):1223-40
Molecular biology of the cell 2009 Feb;20(4):1223-40
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RAB7B monoclonal antibody (M01), clone 3B3. Western Blot analysis of RAB7B expression in human kidney.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RAB7B monoclonal antibody (M01), clone 3B3. Western Blot analysis of RAB7B expression in A-431(Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RAB7B expression in transfected 293T cell line by RAB7B monoclonal antibody (M01), clone 3B3.Lane 1: RAB7B transfected lysate(22.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RAB7B is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of RAB7B transfected lysate using anti-RAB7B monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with RAB7B MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol